| Class i: Low resolution protein structures [58117] (18 folds) |
| Fold i.15: Muscle protein complexes [64616] (1 superfamily) |
Superfamily i.15.1: Muscle protein complexes [64617] (1 family) ![]() |
| Family i.15.1.1: Muscle protein complexes [64618] (2 proteins) |
| Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) |
| Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) |
| Domain d1o1do_: 1o1d O: [80945] |
PDB Entry: 1o1d (more details)
SCOP Domain Sequences for d1o1do_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1do_ i.15.1.1 (O:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus)}
skaaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkilgnpskeemnaaa
itfeeflpmlqaaannkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmteee
veelmkgqedsngcinyeafvkhimsv
Timeline for d1o1do_:
View in 3DDomains from other chains: (mouse over for more information) d1o1d0_, d1o1d1_, d1o1d2_, d1o1d3_, d1o1d4_, d1o1d5_, d1o1d7_, d1o1d8_, d1o1d9_, d1o1da_, d1o1db_, d1o1dc_, d1o1dd_, d1o1de_, d1o1df_, d1o1dg_, d1o1dh_, d1o1di_, d1o1dj_, d1o1dk_, d1o1dl_, d1o1dm_, d1o1dn_, d1o1dp_, d1o1dq_, d1o1dr_, d1o1dv_, d1o1dw_, d1o1dx_, d1o1dy_, d1o1dz_ |