Lineage for d1o1dc_ (1o1d C:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 755365Fold i.15: Muscle protein complexes [64616] (1 superfamily)
  4. 755366Superfamily i.15.1: Muscle protein complexes [64617] (1 family) (S)
  5. 755367Family i.15.1.1: Muscle protein complexes [64618] (3 proteins)
  6. 755372Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species)
  7. 755373Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries)
  8. 755592Domain d1o1dc_: 1o1d C: [80933]

Details for d1o1dc_

PDB Entry: 1o1d (more details)

PDB Description: molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
PDB Compounds: (C:) Skeletal muscle Myosin II Essential Light Chain

SCOP Domain Sequences for d1o1dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1dc_ i.15.1.1 (C:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]}
skaaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkilgnpskeemnaaa
itfeeflpmlqaaannkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmteee
veelmkgqedsngcinyeafvkhimsv

SCOP Domain Coordinates for d1o1dc_:

Click to download the PDB-style file with coordinates for d1o1dc_.
(The format of our PDB-style files is described here.)

Timeline for d1o1dc_: