Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.15: Muscle protein complexes [64616] (1 superfamily) |
Superfamily i.15.1: Muscle protein complexes [64617] (1 family) |
Family i.15.1.1: Muscle protein complexes [64618] (3 proteins) |
Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) |
Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) |
Domain d1o1c8_: 1o1c 8: [80900] |
PDB Entry: 1o1c (more details), 70 Å
SCOPe Domain Sequences for d1o1c8_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1c8_ i.15.1.1 (8:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]} dedettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqs krgiltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmt qimfetfnvpamyvaiqavlslyasgrttgivldsgdgvthnvpiyegyalphaimrldl agrdltdylmkiltergysfvttaereivrdikeklcyvaldfenemataassssleksy elpdgqvitignerfrcpetlfqpsfigmesagihettynsimkcdidirkdlyannvms ggttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwitkq eydeagpsivhr
Timeline for d1o1c8_:
View in 3D Domains from other chains: (mouse over for more information) d1o1c0_, d1o1c1_, d1o1c2_, d1o1c3_, d1o1c4_, d1o1c5_, d1o1c7_, d1o1c9_, d1o1ca_, d1o1cb_, d1o1cc_, d1o1cd_, d1o1ce_, d1o1cf_, d1o1cg_, d1o1ch_, d1o1ci_, d1o1cj_, d1o1ck_, d1o1cl_, d1o1cp_, d1o1cq_, d1o1cr_, d1o1cv_, d1o1cw_, d1o1cx_, d1o1cy_, d1o1cz_ |