Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.15: Muscle protein complexes [64616] (1 superfamily) |
Superfamily i.15.1: Muscle protein complexes [64617] (1 family) |
Family i.15.1.1: Muscle protein complexes [64618] (3 proteins) |
Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) |
Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) |
Domain d1o1b9_: 1o1b 9: [80875] |
PDB Entry: 1o1b (more details), 70 Å
SCOPe Domain Sequences for d1o1b9_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1b9_ i.15.1.1 (9:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]} dedettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqs krgiltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmt qimfetfnvpamyvaiqavlslyasgrttgivldsgdgvthnvpiyegyalphaimrldl agrdltdylmkiltergysfvttaereivrdikeklcyvaldfenemataassssleksy elpdgqvitignerfrcpetlfqpsfigmesagihettynsimkcdidirkdlyannvms ggttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwitkq eydeagpsivhr
Timeline for d1o1b9_: