Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.15: Muscle protein complexes [64616] (1 superfamily) |
Superfamily i.15.1: Muscle protein complexes [64617] (1 family) |
Family i.15.1.1: Muscle protein complexes [64618] (3 proteins) |
Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) |
Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) |
Domain d1o19c_: 1o19 C: [80814] |
PDB Entry: 1o19 (more details), 70 Å
SCOPe Domain Sequences for d1o19c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o19c_ i.15.1.1 (C:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]} skaaaddfkeafllfdrtgdakitasqvgdiaralgqnptnaeinkilgnpskeemnaaa itfeeflpmlqaaannkdqgtfedfveglrvfdkegngtvmgaelrhvlatlgekmteee veelmkgqedsngcinyeafvkhimsv
Timeline for d1o19c_:
View in 3D Domains from other chains: (mouse over for more information) d1o191_, d1o192_, d1o193_, d1o194_, d1o195_, d1o196_, d1o197_, d1o198_, d1o199_, d1o19a_, d1o19b_, d1o19d_, d1o19e_, d1o19f_, d1o19g_, d1o19h_, d1o19i_, d1o19j_, d1o19k_, d1o19l_, d1o19m_, d1o19n_, d1o19o_, d1o19s_, d1o19t_, d1o19u_, d1o19v_, d1o19w_, d1o19x_, d1o19y_, d1o19z_ |