| Class i: Low resolution protein structures [58117] (24 folds) |
| Fold i.15: Muscle protein complexes [64616] (1 superfamily) |
Superfamily i.15.1: Muscle protein complexes [64617] (1 family) ![]() |
| Family i.15.1.1: Muscle protein complexes [64618] (3 proteins) |
| Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) |
| Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) |
| Domain d1o19b_: 1o19 B: [80813] |
PDB Entry: 1o19 (more details)
SCOP Domain Sequences for d1o19b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o19b_ i.15.1.1 (B:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus)}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda
Timeline for d1o19b_:
View in 3DDomains from other chains: (mouse over for more information) d1o191_, d1o192_, d1o193_, d1o194_, d1o195_, d1o196_, d1o197_, d1o198_, d1o199_, d1o19a_, d1o19c_, d1o19d_, d1o19e_, d1o19f_, d1o19g_, d1o19h_, d1o19i_, d1o19j_, d1o19k_, d1o19l_, d1o19m_, d1o19n_, d1o19o_, d1o19s_, d1o19t_, d1o19u_, d1o19v_, d1o19w_, d1o19x_, d1o19y_, d1o19z_ |