Lineage for d1o18h_ (1o18 H:)

  1. Root: SCOP 1.65
  2. 345885Class i: Low resolution protein structures [58117] (18 folds)
  3. 347021Fold i.15: Muscle protein complexes [64616] (1 superfamily)
  4. 347022Superfamily i.15.1: Muscle protein complexes [64617] (1 family) (S)
  5. 347023Family i.15.1.1: Muscle protein complexes [64618] (2 proteins)
  6. 347024Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species)
  7. 347025Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries)
  8. 347124Domain d1o18h_: 1o18 H: [80787]

Details for d1o18h_

PDB Entry: 1o18 (more details)

PDB Description: molecular models of averaged rigor crossbridges from tomograms of insect flight muscle

SCOP Domain Sequences for d1o18h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o18h_ i.15.1.1 (H:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus)}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda

SCOP Domain Coordinates for d1o18h_:

Click to download the PDB-style file with coordinates for d1o18h_.
(The format of our PDB-style files is described here.)

Timeline for d1o18h_: