Lineage for d1o17b2 (1o17 B:71-343)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312560Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 312561Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (1 family) (S)
  5. 312562Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (3 proteins)
  6. 312563Protein Anthranilate phosphoribosyltransferase (TrpD) [82364] (2 species)
  7. 312564Species Archaeon Sulfolobus solfataricus [TaxId:2287] [82365] (2 PDB entries)
  8. 312566Domain d1o17b2: 1o17 B:71-343 [80768]
    Other proteins in same PDB: d1o17a1, d1o17b1, d1o17c1, d1o17d1

Details for d1o17b2

PDB Entry: 1o17 (more details), 2.05 Å

PDB Description: anthranilate phosphoribosyl-transferase (trpd)

SCOP Domain Sequences for d1o17b2:

Sequence, based on SEQRES records: (download)

>d1o17b2 c.27.1.1 (B:71-343) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus}
vpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsadvlealgynii
vpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgpltnpanakyqlm
gvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgieevklnvtd
fgispipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvgdfregye
yadhlieksldklneiismngdvtklktivvks

Sequence, based on observed residues (ATOM records): (download)

>d1o17b2 c.27.1.1 (B:71-343) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus}
vpnaidtagdglgtvnvstasaillslvnpvakhgnravsgksgsadvlealgyniivpp
erakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgpltnpanakyqlmgvf
skdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgieevklnvtdfgi
spipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvgdfregyeyad
hlieksldklneiismngdvtklktivvks

SCOP Domain Coordinates for d1o17b2:

Click to download the PDB-style file with coordinates for d1o17b2.
(The format of our PDB-style files is described here.)

Timeline for d1o17b2: