Lineage for d1o13a_ (1o13 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 246580Superfamily c.55.5: MTH1175-like [53146] (1 family) (S)
  5. 246581Family c.55.5.1: MTH1175-like [53147] (2 proteins)
    Pfam: DUF153; COG1433
  6. 246585Protein Hypothetical protein TM1816 [82446] (1 species)
  7. 246586Species Thermotoga maritima [TaxId:243274] [82447] (1 PDB entry)
  8. 246587Domain d1o13a_: 1o13 A: [80762]
    CASP5
    structural genomics protein; complexed with mse

Details for d1o13a_

PDB Entry: 1o13 (more details), 1.83 Å

PDB Description: crystal structure of a putative dinitrogenase iron-molybdenum cofactor (tm1816) from thermotoga maritima at 1.83 a resolution

SCOP Domain Sequences for d1o13a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o13a_ c.55.5.1 (A:) Hypothetical protein TM1816 {Thermotoga maritima}
miiaipvsenrgkdspisehfgrapyfafvkvknnaiadisveenplaqdhvhgavpnfv
kekgaelvivrgigrraiaafeamgvkvikgasgtveevvnqylsgq

SCOP Domain Coordinates for d1o13a_:

Click to download the PDB-style file with coordinates for d1o13a_.
(The format of our PDB-style files is described here.)

Timeline for d1o13a_: