Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (8 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (12 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species) |
Species Thermotoga maritima [TaxId:2336] [82270] (1 PDB entry) TM1559 |
Domain d1o0yb_: 1o0y B: [80757] structural genomics CASP5 |
PDB Entry: 1o0y (more details), 1.9 Å
SCOP Domain Sequences for d1o0yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0yb_ c.1.10.1 (B:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} hhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpddikklclea renrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifavesgadei dmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacvisklagah fvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygadrigtssgv kivqggeeryg
Timeline for d1o0yb_: