SCOP 1.73: Domain d1o0yb_: 1o0y B:

Lineage for d1o0yb_ (1o0y B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (8 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (12 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)

7. Species Thermotoga maritima [TaxId:2336] [82270] (1 PDB entry)
   TM1559

8. Domain d1o0yb_: 1o0y B: [80757]
   structural genomics
   CASP5

Details for d1o0yb_

PDB Entry: 1o0y, 1.9 Å

PDB Description: Crystal structure of Deoxyribose-phosphate aldolase (TM1559) from Thermotoga maritima at 1.9 A resolution

PDB Compounds: (B:) deoxyribose-phosphate aldolase

SCOP Domain Sequences for d1o0yb_:

Sequence; same for both SEQRES and ATOM records:

>d1o0yb_ c.1.10.1 (B:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]}
hhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpddikklclea
renrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifavesgadei
dmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacvisklagah
fvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygadrigtssgv
kivqggeeryg

Timeline for d1o0yb_:

• d1o0yb_ first appeared in SCOP 1.63
  
• d1o0yb_ appears in SCOP 1.71
  
• d1o0yb_ last appears in SCOP 1.75