SCOP 1.73: Domain d1o0xa_: 1o0x A:

Lineage for d1o0xa_ (1o0x A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Methionine aminopeptidase [55924] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [82780] (1 PDB entry)

8. Domain d1o0xa_: 1o0x A: [80755]
   CASP5

Details for d1o0xa_

PDB Entry: 1o0x, 1.9 Å

PDB Description: crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution

PDB Compounds: (A:) Methionine aminopeptidase

SCOP Domain Sequences for d1o0xa_:

Sequence; same for both SEQRES and ATOM records:

>d1o0xa_ d.127.1.1 (A:) Methionine aminopeptidase {Thermotoga maritima [TaxId: 2336]}
miriktpseiekmkkagkavavalrevrkvivpgktawdvetlvleifkklrvkpafkgy
ggykyatcvsvneevvhglplkekvfkegdivsvdvgavyqglygdaavtyivgetderg
kelvrvtrevlekaikmikpgirlgdvshciqetvesvgfnvirdyvghgvgrelhedpq
ipnygtpgtgvvlrkgmtlaiepmvsegdwrvvvkedgwtavtvdgsrcahfehtilite
ngaeiltke

Timeline for d1o0xa_:

• d1o0xa_ first appeared in SCOP 1.63
  
• d1o0xa_ appears in SCOP 1.71
  
• d1o0xa_ appears in SCOP 1.75
  
• d1o0xa_ appears in the current release, SCOPe 2.08