SCOPe 2.04: Domain d1o0wb2: 1o0w B:168-237

Lineage for d1o0wb2 (1o0w B:168-237)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
   Pfam PF00035

6. Protein RNase III, C-terminal domain [54776] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [82644] (1 PDB entry)

8. Domain d1o0wb2: 1o0w B:168-237 [80754]
   Other proteins in same PDB: d1o0wa1, d1o0wb1
   CASP5

Details for d1o0wb2

PDB Entry: 1o0w, 2 Å

PDB Description: crystal structure of ribonuclease iii (tm1102) from thermotoga maritima at 2.0 a resolution

PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d1o0wb2:

Sequence; same for both SEQRES and ATOM records:

>d1o0wb2 d.50.1.1 (B:168-237) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
dyktalqeivqsehkvppeyilvrtekndgdrifvvevrvngktiatgkgrtkkeaekea
ariayekllk

Timeline for d1o0wb2:

• d1o0wb2 first appeared in SCOP 1.63
  
• d1o0wb2 appears in SCOPe 2.03
  
• d1o0wb2 appears in SCOPe 2.05
  
• d1o0wb2 appears in the current release, SCOPe 2.08