Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) |
Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins) Pfam PF00035 |
Protein RNase III, C-terminal domain [54776] (3 species) |
Species Thermotoga maritima [TaxId:2336] [82644] (1 PDB entry) |
Domain d1o0wb2: 1o0w B:168-237 [80754] Other proteins in same PDB: d1o0wa1, d1o0wb1 CASP5 |
PDB Entry: 1o0w (more details), 2 Å
SCOP Domain Sequences for d1o0wb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0wb2 d.50.1.1 (B:168-237) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} dyktalqeivqsehkvppeyilvrtekndgdrifvvevrvngktiatgkgrtkkeaekea ariayekllk
Timeline for d1o0wb2: