Lineage for d1o0wb1 (1o0w B:-1-167)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361926Fold a.149: RNase III endonuclease catalytic domain [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 361927Superfamily a.149.1: RNase III endonuclease catalytic domain [69065] (1 family) (S)
  5. 361928Family a.149.1.1: RNase III endonuclease catalytic domain [69066] (1 protein)
  6. 361929Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 361942Species Thermotoga maritima [TaxId:243274] [81817] (1 PDB entry)
  8. 361944Domain d1o0wb1: 1o0w B:-1-167 [80753]
    Other proteins in same PDB: d1o0wa2, d1o0wb2
    CASP5

Details for d1o0wb1

PDB Entry: 1o0w (more details), 2 Å

PDB Description: crystal structure of ribonuclease iii (tm1102) from thermotoga maritima at 2.0 a resolution

SCOP Domain Sequences for d1o0wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0wb1 a.149.1.1 (B:-1-167) RNase III endonuclease catalytic domain {Thermotoga maritima}
hhmneserkiveefqketginfkneellfralchssyaneqnqagrkdvesnekleflgd
avlelfvceilykkypeaevgdlarvksaaaseevlamvsrkmnlgkflflgkgeektgg
rdrdsiladafeallaaiyldqgyekikelfeqefefyiekimkgemlf

SCOP Domain Coordinates for d1o0wb1:

Click to download the PDB-style file with coordinates for d1o0wb1.
(The format of our PDB-style files is described here.)

Timeline for d1o0wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o0wb2