SCOP 1.65: Domain d1o0wb1: 1o0w B:-1-167

Lineage for d1o0wb1 (1o0w B:-1-167)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.149: RNase III endonuclease catalytic domain [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III endonuclease catalytic domain [69065] (1 family)

5. Family a.149.1.1: RNase III endonuclease catalytic domain [69066] (1 protein)

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Thermotoga maritima [TaxId:243274] [81817] (1 PDB entry)

8. Domain d1o0wb1: 1o0w B:-1-167 [80753]
   Other proteins in same PDB: d1o0wa2, d1o0wb2
   CASP5

Details for d1o0wb1

PDB Entry: 1o0w, 2 Å

PDB Description: crystal structure of ribonuclease iii (tm1102) from thermotoga maritima at 2.0 a resolution

SCOP Domain Sequences for d1o0wb1:

Sequence; same for both SEQRES and ATOM records:

>d1o0wb1 a.149.1.1 (B:-1-167) RNase III endonuclease catalytic domain {Thermotoga maritima}
hhmneserkiveefqketginfkneellfralchssyaneqnqagrkdvesnekleflgd
avlelfvceilykkypeaevgdlarvksaaaseevlamvsrkmnlgkflflgkgeektgg
rdrdsiladafeallaaiyldqgyekikelfeqefefyiekimkgemlf

Timeline for d1o0wb1:

• d1o0wb1 first appeared in SCOP 1.63
  
• d1o0wb1 appears in SCOP 1.67
  
• d1o0wb1 appears in the current release, SCOPe 2.08