Class a: All alpha proteins [46456] (179 folds) |
Fold a.149: RNase III endonuclease catalytic domain [69064] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.149.1: RNase III endonuclease catalytic domain [69065] (1 family) |
Family a.149.1.1: RNase III endonuclease catalytic domain [69066] (1 protein) |
Protein RNase III endonuclease catalytic domain [69067] (2 species) |
Species Thermotoga maritima [TaxId:243274] [81817] (1 PDB entry) |
Domain d1o0wb1: 1o0w B:-1-167 [80753] Other proteins in same PDB: d1o0wa2, d1o0wb2 CASP5 |
PDB Entry: 1o0w (more details), 2 Å
SCOP Domain Sequences for d1o0wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0wb1 a.149.1.1 (B:-1-167) RNase III endonuclease catalytic domain {Thermotoga maritima} hhmneserkiveefqketginfkneellfralchssyaneqnqagrkdvesnekleflgd avlelfvceilykkypeaevgdlarvksaaaseevlamvsrkmnlgkflflgkgeektgg rdrdsiladafeallaaiyldqgyekikelfeqefefyiekimkgemlf
Timeline for d1o0wb1: