Lineage for d1o0wa1 (1o0w A:1-167)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017406Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2017407Superfamily a.149.1: RNase III domain-like [69065] (3 families) (S)
  5. 2017408Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
    Pfam PF00636
  6. 2017412Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 2017443Species Thermotoga maritima [TaxId:2336] [81817] (1 PDB entry)
  8. 2017444Domain d1o0wa1: 1o0w A:1-167 [80751]
    Other proteins in same PDB: d1o0wa2, d1o0wa3, d1o0wb2, d1o0wb3
    CASP5

Details for d1o0wa1

PDB Entry: 1o0w (more details), 2 Å

PDB Description: crystal structure of ribonuclease iii (tm1102) from thermotoga maritima at 2.0 a resolution
PDB Compounds: (A:) Ribonuclease III

SCOPe Domain Sequences for d1o0wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0wa1 a.149.1.1 (A:1-167) RNase III endonuclease catalytic domain {Thermotoga maritima [TaxId: 2336]}
mneserkiveefqketginfkneellfralchssyaneqnqagrkdvesnekleflgdav
lelfvceilykkypeaevgdlarvksaaaseevlamvsrkmnlgkflflgkgeektggrd
rdsiladafeallaaiyldqgyekikelfeqefefyiekimkgemlf

SCOPe Domain Coordinates for d1o0wa1:

Click to download the PDB-style file with coordinates for d1o0wa1.
(The format of our PDB-style files is described here.)

Timeline for d1o0wa1: