![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.149: RNase III domain-like [69064] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.149.1: RNase III domain-like [69065] (3 families) ![]() |
![]() | Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins) Pfam PF00636 |
![]() | Protein RNase III endonuclease catalytic domain [69067] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [81817] (1 PDB entry) |
![]() | Domain d1o0wa1: 1o0w A:1-167 [80751] Other proteins in same PDB: d1o0wa2, d1o0wa3, d1o0wb2, d1o0wb3 CASP5 |
PDB Entry: 1o0w (more details), 2 Å
SCOPe Domain Sequences for d1o0wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0wa1 a.149.1.1 (A:1-167) RNase III endonuclease catalytic domain {Thermotoga maritima [TaxId: 2336]} mneserkiveefqketginfkneellfralchssyaneqnqagrkdvesnekleflgdav lelfvceilykkypeaevgdlarvksaaaseevlamvsrkmnlgkflflgkgeektggrd rdsiladafeallaaiyldqgyekikelfeqefefyiekimkgemlf
Timeline for d1o0wa1: