SCOP 1.67: Domain d1o0vb3: 1o0v B:439-546

Lineage for d1o0vb3 (1o0v B:439-546)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88599] (3 PDB entries)

8. Domain d1o0vb3: 1o0v B:439-546 [80750]
   Other proteins in same PDB: d1o0va1, d1o0va2, d1o0vb1, d1o0vb2
   complexed with gol, man, nag, so4; mutant

Details for d1o0vb3

PDB Entry: 1o0v, 2.6 Å

PDB Description: the crystal structure of ige fc reveals an asymmetrically bent conformation

SCOP Domain Sequences for d1o0vb3:

Sequence; same for both SEQRES and ATOM records:

>d1o0vb3 b.1.1.2 (B:439-546) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens)}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnpg

Timeline for d1o0vb3:

• d1o0vb3 first appeared in SCOP 1.63
  
• d1o0vb3 appears in SCOP 1.65
  
• d1o0vb3 appears in SCOP 1.69
  
• d1o0vb3 appears in the current release, SCOPe 2.08