Lineage for d1o0vb1 (1o0v B:228-330)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289081Protein Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon [88594] (1 species)
  7. 289082Species Human (Homo sapiens) [TaxId:9606] [88595] (2 PDB entries)
  8. 289084Domain d1o0vb1: 1o0v B:228-330 [80748]
    Other proteins in same PDB: d1o0va2, d1o0va3, d1o0vb2, d1o0vb3
    complexed with gol, man, nag, so4; mutant

Details for d1o0vb1

PDB Entry: 1o0v (more details), 2.6 Å

PDB Description: the crystal structure of ige fc reveals an asymmetrically bent conformation

SCOP Domain Sequences for d1o0vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0vb1 b.1.1.2 (B:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens)}
dftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttq
egelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcad

SCOP Domain Coordinates for d1o0vb1:

Click to download the PDB-style file with coordinates for d1o0vb1.
(The format of our PDB-style files is described here.)

Timeline for d1o0vb1: