Lineage for d1o0va3 (1o0v A:439-545)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747660Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species)
  7. 2747661Species Human (Homo sapiens) [TaxId:9606] [88599] (4 PDB entries)
  8. 2747665Domain d1o0va3: 1o0v A:439-545 [80747]
    Other proteins in same PDB: d1o0va1, d1o0va2, d1o0vb1, d1o0vb2
    complexed with gol, so4

Details for d1o0va3

PDB Entry: 1o0v (more details), 2.6 Å

PDB Description: the crystal structure of ige fc reveals an asymmetrically bent conformation
PDB Compounds: (A:) Immunoglobulin heavy chain epsilon-1

SCOPe Domain Sequences for d1o0va3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0va3 b.1.1.2 (A:439-545) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnp

SCOPe Domain Coordinates for d1o0va3:

Click to download the PDB-style file with coordinates for d1o0va3.
(The format of our PDB-style files is described here.)

Timeline for d1o0va3: