SCOP 1.65: Domain d1o0va2: 1o0v A:331-438

Lineage for d1o0va2 (1o0v A:331-438)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon [88596] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88597] (3 PDB entries)

8. Domain d1o0va2: 1o0v A:331-438 [80746]
   Other proteins in same PDB: d1o0va1, d1o0va3, d1o0vb1, d1o0vb3

Details for d1o0va2

PDB Entry: 1o0v, 2.6 Å

PDB Description: the crystal structure of ige fc reveals an asymmetrically bent conformation

SCOP Domain Sequences for d1o0va2:

Sequence; same for both SEQRES and ATOM records:

>d1o0va2 b.1.1.2 (A:331-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens)}
snprgvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkee
kqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

Timeline for d1o0va2:

• d1o0va2 first appeared in SCOP 1.63
  
• d1o0va2 appears in SCOP 1.67
  
• d1o0va2 appears in the current release, SCOPe 2.08