SCOP 1.63: Domain d1o0va2: 1o0v A:331-438

Lineage for d1o0va2 (1o0v A:331-438)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fc (human) IgE [49121] (3 PDB entries)

8. Domain d1o0va2: 1o0v A:331-438 [80746]

Details for d1o0va2

PDB Entry: 1o0v, 2.6 Å

PDB Description: the crystal structure of ige fc reveals an asymmetrically bent conformation

SCOP Domain Sequences for d1o0va2:

Sequence; same for both SEQRES and ATOM records:

>d1o0va2 b.1.1.2 (A:331-438) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgE}
snprgvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkee
kqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

Timeline for d1o0va2:

• d1o0va2 is new in SCOP 1.63
  
• d1o0va2 appears in SCOP 1.65
  
• d1o0va2 appears in the current release, SCOPe 2.08