Lineage for d1o0ub_ (1o0u B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 251682Fold c.118: Putative glycerate kinase (hypothetical protein TM1585) [82543] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 6 strands, order 321456, Rossmann-like topology
    Domain 2 has mixed sheet of 6 strands, order 126345; strands 5 and 6 are antiparallel to the rest; some similarity to CbiF Domain 2
  4. 251683Superfamily c.118.1: Putative glycerate kinase (hypothetical protein TM1585) [82544] (1 family) (S)
  5. 251684Family c.118.1.1: Putative glycerate kinase (hypothetical protein TM1585) [82545] (1 protein)
  6. 251685Protein Putative glycerate kinase (hypothetical protein TM1585) [82546] (1 species)
  7. 251686Species Thermotoga maritima [TaxId:243274] [82547] (1 PDB entry)
  8. 251688Domain d1o0ub_: 1o0u B: [80744]
    CASP5
    structural genomics protein

Details for d1o0ub_

PDB Entry: 1o0u (more details), 2.95 Å

PDB Description: Crystal structure of Glycerate kinase (TM1585) from Thermotoga maritima at 2.95 A resolution

SCOP Domain Sequences for d1o0ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0ub_ c.118.1.1 (B:) Putative glycerate kinase (hypothetical protein TM1585) {Thermotoga maritima}
peslkklaieivkksieavfpdravketlpklnldrvilvavgkaawrmakaayevlgkk
irkgvvvtkyghsegpiddfeiyeaghpvpdentikttrrvlelvdqlnendtvlfllsg
ggsslfelplegvsleeiqkltsallksgasieeintvrkhlsqvkggrfaervfpakvv
alvlsdvlgdrldviasgpawpdsstsedalkvlekygietsesvkrailqetpkhlsnv
eihlignvqkvcdeakslakekgfnaeiittsldceareagrfiasimkevkfkdrplkk
paalifggetvvhvkgngiggrnqelalsaaialegiegvilcsagtdgtdgptdaaggi
vdgstaktlkamgedpyqylknndsynalkksgallitgptgtnvndliigliv

SCOP Domain Coordinates for d1o0ub_:

Click to download the PDB-style file with coordinates for d1o0ub_.
(The format of our PDB-style files is described here.)

Timeline for d1o0ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o0ua_