![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.118: Putative glycerate kinase (hypothetical protein TM1585) [82543] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 6 strands, order 321456, Rossmann-like topology Domain 2 has mixed sheet of 6 strands, order 126345; strands 5 and 6 are antiparallel to the rest; some similarity to CbiF Domain 2 |
![]() | Superfamily c.118.1: Putative glycerate kinase (hypothetical protein TM1585) [82544] (1 family) ![]() |
![]() | Family c.118.1.1: Putative glycerate kinase (hypothetical protein TM1585) [82545] (1 protein) |
![]() | Protein Putative glycerate kinase (hypothetical protein TM1585) [82546] (1 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [82547] (1 PDB entry) |
![]() | Domain d1o0ub_: 1o0u B: [80744] CASP5 structural genomics protein |
PDB Entry: 1o0u (more details), 2.95 Å
SCOP Domain Sequences for d1o0ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0ub_ c.118.1.1 (B:) Putative glycerate kinase (hypothetical protein TM1585) {Thermotoga maritima} peslkklaieivkksieavfpdravketlpklnldrvilvavgkaawrmakaayevlgkk irkgvvvtkyghsegpiddfeiyeaghpvpdentikttrrvlelvdqlnendtvlfllsg ggsslfelplegvsleeiqkltsallksgasieeintvrkhlsqvkggrfaervfpakvv alvlsdvlgdrldviasgpawpdsstsedalkvlekygietsesvkrailqetpkhlsnv eihlignvqkvcdeakslakekgfnaeiittsldceareagrfiasimkevkfkdrplkk paalifggetvvhvkgngiggrnqelalsaaialegiegvilcsagtdgtdgptdaaggi vdgstaktlkamgedpyqylknndsynalkksgallitgptgtnvndliigliv
Timeline for d1o0ub_: