Lineage for d1nunb2 (1nun B:251-359)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1518665Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1518734Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 1518790Species Human (Homo sapiens), FGFR2b [TaxId:9606] [81955] (1 PDB entry)
  8. 1518792Domain d1nunb2: 1nun B:251-359 [80736]
    Other proteins in same PDB: d1nuna_
    complexed with 15p, so4

Details for d1nunb2

PDB Entry: 1nun (more details), 2.9 Å

PDB Description: Crystal Structure Analysis of the FGF10-FGFR2b Complex
PDB Compounds: (B:) fibroblast growth factor receptor 2 isoform 2

SCOPe Domain Sequences for d1nunb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nunb2 b.1.1.4 (B:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2b [TaxId: 9606]}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkhsginssnaevlalfnvteadageyickvsnyigqanqsawltvlp

SCOPe Domain Coordinates for d1nunb2:

Click to download the PDB-style file with coordinates for d1nunb2.
(The format of our PDB-style files is described here.)

Timeline for d1nunb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nunb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1nuna_