SCOP 1.71: Domain d1nunb2: 1nun B:251-359

Lineage for d1nunb2 (1nun B:251-359)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (34 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR2b [TaxId:9606] [81955] (1 PDB entry)

8. Domain d1nunb2: 1nun B:251-359 [80736]
   Other proteins in same PDB: d1nuna_
   complexed with 15p, mse, so4

Details for d1nunb2

PDB Entry: 1nun, 2.9 Å

PDB Description: Crystal Structure Analysis of the FGF10-FGFR2b Complex

SCOP Domain Sequences for d1nunb2:

Sequence; same for both SEQRES and ATOM records:

>d1nunb2 b.1.1.4 (B:251-359) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2b}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkhsginssnaevlalfnvteadageyickvsnyigqanqsawltvlp

Timeline for d1nunb2:

• d1nunb2 first appeared in SCOP 1.63
  
• d1nunb2 appears in SCOP 1.69
  
• d1nunb2 appears in SCOP 1.73
  
• d1nunb2 appears in the current release, SCOPe 2.08