SCOPe 2.03: Domain d1nunb1: 1nun B:151-250

Lineage for d1nunb1 (1nun B:151-250)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR2b [TaxId:9606] [81955] (1 PDB entry)

8. Domain d1nunb1: 1nun B:151-250 [80735]
   Other proteins in same PDB: d1nuna_
   complexed with 15p, so4

Details for d1nunb1

PDB Entry: 1nun, 2.9 Å

PDB Description: Crystal Structure Analysis of the FGF10-FGFR2b Complex

PDB Compounds: (B:) fibroblast growth factor receptor 2 isoform 2

SCOPe Domain Sequences for d1nunb1:

Sequence; same for both SEQRES and ATOM records:

>d1nunb1 b.1.1.4 (B:151-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2b [TaxId: 9606]}
krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
nqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

Timeline for d1nunb1:

• d1nunb1 first appeared in SCOP 1.63
  
• d1nunb1 appears in SCOPe 2.02
  
• d1nunb1 appears in SCOPe 2.04
  
• d1nunb1 appears in the current release, SCOPe 2.08