Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (27 proteins) |
Protein Fibroblast growth factor receptor, FGFR [49179] (3 species) |
Species Human (Homo sapiens), FGFR2b [TaxId:9606] [81955] (1 PDB entry) |
Domain d1nunb1: 1nun B:151-250 [80735] Other proteins in same PDB: d1nuna_ |
PDB Entry: 1nun (more details), 2.9 Å
SCOP Domain Sequences for d1nunb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nunb1 b.1.1.4 (B:151-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2b} krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr nqhwslimesvvpsdkgnytcvveneygsinhtyhldvve
Timeline for d1nunb1: