Lineage for d1nunb1 (1nun B:151-250)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 222108Family b.1.1.4: I set domains [49159] (27 proteins)
  6. 222144Protein Fibroblast growth factor receptor, FGFR [49179] (3 species)
  7. 222189Species Human (Homo sapiens), FGFR2b [TaxId:9606] [81955] (1 PDB entry)
  8. 222190Domain d1nunb1: 1nun B:151-250 [80735]
    Other proteins in same PDB: d1nuna_

Details for d1nunb1

PDB Entry: 1nun (more details), 2.9 Å

PDB Description: Crystal Structure Analysis of the FGF10-FGFR2b Complex

SCOP Domain Sequences for d1nunb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nunb1 b.1.1.4 (B:151-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2b}
krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
nqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

SCOP Domain Coordinates for d1nunb1:

Click to download the PDB-style file with coordinates for d1nunb1.
(The format of our PDB-style files is described here.)

Timeline for d1nunb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nunb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1nuna_