![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
![]() | Species Human (Homo sapiens), FGFR2b [TaxId:9606] [81955] (1 PDB entry) |
![]() | Domain d1nunb1: 1nun B:151-250 [80735] Other proteins in same PDB: d1nuna_ complexed with 15p, so4 |
PDB Entry: 1nun (more details), 2.9 Å
SCOPe Domain Sequences for d1nunb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nunb1 b.1.1.4 (B:151-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2b [TaxId: 9606]} krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr nqhwslimesvvpsdkgnytcvveneygsinhtyhldvve
Timeline for d1nunb1: