Lineage for d1nuna_ (1nun A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316302Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1316303Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1316304Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1316557Protein Fibroblast growth factor-10, FGF10 [82107] (1 species)
  7. 1316558Species Human (Homo sapiens) [TaxId:9606] [82108] (1 PDB entry)
  8. 1316559Domain d1nuna_: 1nun A: [80734]
    Other proteins in same PDB: d1nunb1, d1nunb2
    complexed with 15p, so4

Details for d1nuna_

PDB Entry: 1nun (more details), 2.9 Å

PDB Description: Crystal Structure Analysis of the FGF10-FGFR2b Complex
PDB Compounds: (A:) Fibroblast growth factor-10

SCOPe Domain Sequences for d1nuna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nuna_ b.42.1.1 (A:) Fibroblast growth factor-10, FGF10 {Human (Homo sapiens) [TaxId: 9606]}
synhlqgdvrwrklfsftkyflkiekngkvsgtkkencpysileitsveigvvavkains
nyylamnkkgklygskefnndcklkerieengyntyasfnwqhngrqmyvalngkgaprr
gqktrrkntsahflpmvvh

SCOPe Domain Coordinates for d1nuna_:

Click to download the PDB-style file with coordinates for d1nuna_.
(The format of our PDB-style files is described here.)

Timeline for d1nuna_: