Class b: All beta proteins [48724] (141 folds) |
Fold b.42: beta-Trefoil [50352] (6 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (2 families) |
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins) |
Protein Fibroblast growth factor-10, FGF10 [82107] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82108] (1 PDB entry) |
Domain d1nuna_: 1nun A: [80734] Other proteins in same PDB: d1nunb1, d1nunb2 complexed with 15p, mse, so4 |
PDB Entry: 1nun (more details), 2.9 Å
SCOP Domain Sequences for d1nuna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nuna_ b.42.1.1 (A:) Fibroblast growth factor-10, FGF10 {Human (Homo sapiens)} synhlqgdvrwrklfsftkyflkiekngkvsgtkkencpysileitsveigvvavkains nyylamnkkgklygskefnndcklkerieengyntyasfnwqhngrqmyvalngkgaprr gqktrrkntsahflpmvvh
Timeline for d1nuna_: