SCOPe 2.07: Domain d1nu4b_: 1nu4 B:

Lineage for d1nu4b_ (1nu4 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Splicesomal U1A protein [54932] (2 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (54 PDB entries)
   Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98

8. Domain d1nu4b_: 1nu4 B: [80732]
   contains a pre-organized C-terminal helix
   complexed with mg, mla

Details for d1nu4b_

PDB Entry: 1nu4, 1.8 Å

PDB Description: u1a rna binding domain at 1.8 angstrom resolution reveals a pre- organized c-terminal helix

PDB Compounds: (B:) U1A RNA binding domain

SCOPe Domain Sequences for d1nu4b_:

Sequence; same for both SEQRES and ATOM records:

>d1nu4b_ d.58.7.1 (B:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktdsdiiakmk

Timeline for d1nu4b_:

• d1nu4b_ first appeared in SCOP 1.63
  
• d1nu4b_ appears in SCOPe 2.06
  
• d1nu4b_ appears in the current release, SCOPe 2.08