Lineage for d1nszb1 (1nsz B:3-339)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391546Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins)
    automatically mapped to Pfam PF01263
  6. 2391551Protein Galactose mutarotase [74912] (3 species)
  7. 2391561Species Lactococcus lactis [TaxId:1358] [74913] (19 PDB entries)
  8. 2391563Domain d1nszb1: 1nsz B:3-339 [80725]
    Other proteins in same PDB: d1nsza2, d1nsza3, d1nszb2, d1nszb3
    complexed with glc, na; mutant

Details for d1nszb1

PDB Entry: 1nsz (more details), 1.75 Å

PDB Description: crystal structure of galactose mutarotase from lactococcus lactis mutant h170n complexed with glucose
PDB Compounds: (B:) galactose mutarotase

SCOPe Domain Sequences for d1nszb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nszb1 b.30.5.4 (B:3-339) Galactose mutarotase {Lactococcus lactis [TaxId: 1358]}
ikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdaypg
atvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvkf
slvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptgnvyfnlngdases
venhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkgi
dhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggit
fecqvspgseqipelgdislkagekyqattiyslhtk

SCOPe Domain Coordinates for d1nszb1:

Click to download the PDB-style file with coordinates for d1nszb1.
(The format of our PDB-style files is described here.)

Timeline for d1nszb1: