Lineage for d1nsxb_ (1nsx B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664384Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 664501Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 664706Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins)
  6. 664711Protein Galactose mutarotase [74912] (3 species)
  7. 664721Species Lactococcus lactis [TaxId:1358] [74913] (19 PDB entries)
  8. 664725Domain d1nsxb_: 1nsx B: [80723]
    complexed with gal, na; mutant

Details for d1nsxb_

PDB Entry: 1nsx (more details), 1.75 Å

PDB Description: crystal structure of galactose mutarotase from lactococcus lactis mutant h170n complexed with galactose
PDB Compounds: (B:) galactose mutarotase

SCOP Domain Sequences for d1nsxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsxb_ b.30.5.4 (B:) Galactose mutarotase {Lactococcus lactis [TaxId: 1358]}
sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptgnvyfnlngdase
svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
idhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
tfecqvspgseqipelgdislkagekyqattiyslhtklehhhhhh

SCOP Domain Coordinates for d1nsxb_:

Click to download the PDB-style file with coordinates for d1nsxb_.
(The format of our PDB-style files is described here.)

Timeline for d1nsxb_: