Lineage for d1nsrb1 (1nsr B:3-339)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2044950Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 protein domains)
    automatically mapped to Pfam PF01263
  6. 2044955Protein Galactose mutarotase [74912] (3 species)
  7. 2044965Species Lactococcus lactis [TaxId:1358] [74913] (19 PDB entries)
  8. 2044987Domain d1nsrb1: 1nsr B:3-339 [80715]
    Other proteins in same PDB: d1nsra2, d1nsra3, d1nsrb2, d1nsrb3
    complexed with bgc, na; mutant

Details for d1nsrb1

PDB Entry: 1nsr (more details), 1.8 Å

PDB Description: crystal structure of galactose mutarotase from lactococcus lactis mutant d243n complexed with glucose
PDB Compounds: (B:) galactose mutarotase

SCOPe Domain Sequences for d1nsrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsrb1 b.30.5.4 (B:3-339) Galactose mutarotase {Lactococcus lactis [TaxId: 1358]}
ikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdaypg
atvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvkf
slvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdases
venhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkgi
nhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggit
fecqvspgseqipelgdislkagekyqattiyslhtk

SCOPe Domain Coordinates for d1nsrb1:

Click to download the PDB-style file with coordinates for d1nsrb1.
(The format of our PDB-style files is described here.)

Timeline for d1nsrb1: