![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (2 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Mason-Pfizer monkey virus protease [82131] (1 species) |
![]() | Species Simian retrovirus, SRV-1 [82132] (1 PDB entry) |
![]() | Domain d1nsoa_: 1nso A: [80713] folded monomer mutant |
PDB Entry: 1nso (more details)
SCOP Domain Sequences for d1nsoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nsoa_ b.50.1.1 (A:) Mason-Pfizer monkey virus protease {Simian retrovirus, SRV-1} wvqpitaqkpsltlwlddkmftglintgadvtiikledwppnwpitdtltnlrgigqsnn pkqsskyltwrdkennsglikpfvipnlpvnlwgrdllsqmkimmas
Timeline for d1nsoa_: