Lineage for d1nsoa_ (1nso A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 299835Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 299836Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 299837Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 300195Protein Mason-Pfizer monkey virus protease [82131] (1 species)
  7. 300196Species Simian retrovirus, SRV-1 [82132] (1 PDB entry)
  8. 300197Domain d1nsoa_: 1nso A: [80713]
    folded monomer
    mutant

Details for d1nsoa_

PDB Entry: 1nso (more details)

PDB Description: folded monomer of protease from mason-pfizer monkey virus

SCOP Domain Sequences for d1nsoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsoa_ b.50.1.1 (A:) Mason-Pfizer monkey virus protease {Simian retrovirus, SRV-1}
wvqpitaqkpsltlwlddkmftglintgadvtiikledwppnwpitdtltnlrgigqsnn
pkqsskyltwrdkennsglikpfvipnlpvnlwgrdllsqmkimmas

SCOP Domain Coordinates for d1nsoa_:

Click to download the PDB-style file with coordinates for d1nsoa_.
(The format of our PDB-style files is described here.)

Timeline for d1nsoa_: