Lineage for d1ns8b1 (1ns8 B:3-339)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781904Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins)
    automatically mapped to Pfam PF01263
  6. 2781909Protein Galactose mutarotase [74912] (3 species)
  7. 2781919Species Lactococcus lactis [TaxId:1358] [74913] (19 PDB entries)
  8. 2781949Domain d1ns8b1: 1ns8 B:3-339 [80710]
    Other proteins in same PDB: d1ns8a2, d1ns8a3, d1ns8b2, d1ns8b3
    complexed with gla, na; mutant

Details for d1ns8b1

PDB Entry: 1ns8 (more details), 1.8 Å

PDB Description: crystal structure of galactose mutarotase from lactococcus lactis mutant d243n complexed with galactose
PDB Compounds: (B:) galactose mutarotase

SCOPe Domain Sequences for d1ns8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ns8b1 b.30.5.4 (B:3-339) Galactose mutarotase {Lactococcus lactis [TaxId: 1358]}
ikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdaypg
atvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvkf
slvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdases
venhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkgi
nhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggit
fecqvspgseqipelgdislkagekyqattiyslhtk

SCOPe Domain Coordinates for d1ns8b1:

Click to download the PDB-style file with coordinates for d1ns8b1.
(The format of our PDB-style files is described here.)

Timeline for d1ns8b1: