Lineage for d1ns8a_ (1ns8 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295197Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 295253Superfamily b.30.5: Galactose mutarotase-like [74650] (8 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 295417Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins)
  6. 295422Protein Galactose mutarotase [74912] (1 species)
  7. 295423Species Lactococcus lactis [TaxId:1358] [74913] (19 PDB entries)
  8. 295448Domain d1ns8a_: 1ns8 A: [80709]

Details for d1ns8a_

PDB Entry: 1ns8 (more details), 1.8 Å

PDB Description: crystal structure of galactose mutarotase from lactococcus lactis mutant d243n complexed with galactose

SCOP Domain Sequences for d1ns8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ns8a_ b.30.5.4 (A:) Galactose mutarotase {Lactococcus lactis}
sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
inhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
tfecqvspgseqipelgdislkagekyqattiyslhtkl

SCOP Domain Coordinates for d1ns8a_:

Click to download the PDB-style file with coordinates for d1ns8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ns8a_: