Lineage for d1ns5a_ (1ns5 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 251617Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 251618Superfamily c.116.1: alpha/beta knot [75217] (3 families) (S)
    known or predicted SAM-dependent methytransferases; all known members have dimeric structures
  5. 251642Family c.116.1.3: YbeA-like [82371] (1 protein)
  6. 251643Protein Hypothetical protein YbeA [82372] (1 species)
  7. 251644Species Escherichia coli [TaxId:562] [82373] (1 PDB entry)
  8. 251645Domain d1ns5a_: 1ns5 A: [80705]

Details for d1ns5a_

PDB Entry: 1ns5 (more details), 1.68 Å

PDB Description: x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45

SCOP Domain Sequences for d1ns5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ns5a_ c.116.1.3 (A:) Hypothetical protein YbeA {Escherichia coli}
mklqlvavgtkmpdwvqtgfteylrrfpkdmpfelieipagkrgknadikrildkegeqm
laaagknrivtldipgkpwdtpqlaaelerwkldgrdvslliggpeglspackaaaeqsw
slsaltlphplvrvlvaeslyrawsittnhpyh

SCOP Domain Coordinates for d1ns5a_:

Click to download the PDB-style file with coordinates for d1ns5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ns5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ns5b_