SCOP 1.63: Domain d1ns5a_: 1ns5 A:

Lineage for d1ns5a_ (1ns5 A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (3 families)
   known or predicted SAM-dependent methytransferases; all known members have dimeric structures

5. Family c.116.1.3: YbeA-like [82371] (1 protein)

6. Protein Hypothetical protein YbeA [82372] (1 species)

7. Species Escherichia coli [TaxId:562] [82373] (1 PDB entry)

8. Domain d1ns5a_: 1ns5 A: [80705]

Details for d1ns5a_

PDB Entry: 1ns5, 1.68 Å

PDB Description: x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45

SCOP Domain Sequences for d1ns5a_:

Sequence; same for both SEQRES and ATOM records:

>d1ns5a_ c.116.1.3 (A:) Hypothetical protein YbeA {Escherichia coli}
mklqlvavgtkmpdwvqtgfteylrrfpkdmpfelieipagkrgknadikrildkegeqm
laaagknrivtldipgkpwdtpqlaaelerwkldgrdvslliggpeglspackaaaeqsw
slsaltlphplvrvlvaeslyrawsittnhpyh

Timeline for d1ns5a_:

• d1ns5a_ is new in SCOP 1.63
  
• d1ns5a_ appears in SCOP 1.65
  
• d1ns5a_ appears in the current release, SCOPe 2.08