Lineage for d1ns0a_ (1ns0 A:)
- Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds) 
Fold b.30: Supersandwich [49993] (3 superfamilies)
sandwich; 18 strands in 2 sheetsSuperfamily b.30.5: Galactose mutarotase-like [74650] (8 families) 
probable carbohydrate-binding domain in enzymes acting on sugars
Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins) Protein Galactose mutarotase [74912] (1 species) Species Lactococcus lactis [TaxId:1358] [74913] (19 PDB entries) 
Domain d1ns0a_: 1ns0 A: [80699]
Details for d1ns0a_
PDB Entry: 1ns0 (more details), 1.85 Å
PDB Description: crystal structure of galactose mutarotase from lactococcus lactis mutant e304q complexed with galactose
SCOP Domain Sequences for d1ns0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ns0a_ b.30.5.4 (A:) Galactose mutarotase {Lactococcus lactis}
sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
idhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
tfqcqvspgseqipelgdislkagekyqattiyslhtkle
SCOP Domain Coordinates for d1ns0a_:
Click to download the PDB-style file with coordinates for d1ns0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ns0a_:
- d1ns0a_ first appeared in SCOP 1.63
- d1ns0a_ appears in SCOP 1.67
- d1ns0a_ appears in the current release, SCOPe 2.08, called d1ns0a1
View in 3D
