Lineage for d1nqic_ (1nqi C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2924220Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 2924253Species Mouse (Mus musculus) [TaxId:10090] [69628] (14 PDB entries)
  8. 2924269Domain d1nqic_: 1nqi C: [80692]
    Other proteins in same PDB: d1nqib_, d1nqid_
    complexed with ca, nag

Details for d1nqic_

PDB Entry: 1nqi (more details), 2 Å

PDB Description: crystal structure of lactose synthase, a 1:1 complex between beta1,4- galactosyltransferase and alpha-lactalbumin in the presence of glcnac
PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1nqic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqic_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOPe Domain Coordinates for d1nqic_:

Click to download the PDB-style file with coordinates for d1nqic_.
(The format of our PDB-style files is described here.)

Timeline for d1nqic_: