SCOP 1.71: Domain d1npdb2: 1npd B:1-106

Lineage for d1npdb2 (1npd B:1-106)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)

6. Protein Putative shikimate dehydrogenase YdiB [82337] (1 species)

7. Species Escherichia coli [TaxId:562] [82338] (3 PDB entries)

8. Domain d1npdb2: 1npd B:1-106 [80684]
   Other proteins in same PDB: d1npda1, d1npdb1
   structural genomics
   complexed with mse, nad

Details for d1npdb2

PDB Entry: 1npd, 2.3 Å

PDB Description: x-ray structure of shikimate dehydrogenase complexed with nad+ from e.coli (ydib) northeast structural genomics research consortium (nesg) target er24

SCOP Domain Sequences for d1npdb2:

Sequence; same for both SEQRES and ATOM records:

>d1npdb2 c.58.1.5 (B:1-106) Putative shikimate dehydrogenase YdiB {Escherichia coli}
mdvtakyeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalk
mrgtgvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgynt

Timeline for d1npdb2:

• d1npdb2 first appeared in SCOP 1.63
  
• d1npdb2 appears in SCOP 1.69
  
• d1npdb2 appears in SCOP 1.73
  
• d1npdb2 appears in the current release, SCOPe 2.08