Lineage for d1npdb2 (1npd B:1-106)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 317634Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 317635Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 317832Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)
  6. 317833Protein Putative shikimate dehydrogenase YdiB [82337] (1 species)
  7. 317834Species Escherichia coli [TaxId:562] [82338] (2 PDB entries)
  8. 317836Domain d1npdb2: 1npd B:1-106 [80684]
    Other proteins in same PDB: d1npda1, d1npdb1
    structural genomics
    complexed with mse, nad

Details for d1npdb2

PDB Entry: 1npd (more details), 2.3 Å

PDB Description: x-ray structure of shikimate dehydrogenase complexed with nad+ from e.coli (ydib) northeast structural genomics research consortium (nesg) target er24

SCOP Domain Sequences for d1npdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npdb2 c.58.1.5 (B:1-106) Putative shikimate dehydrogenase YdiB {Escherichia coli}
mdvtakyeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalk
mrgtgvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgynt

SCOP Domain Coordinates for d1npdb2:

Click to download the PDB-style file with coordinates for d1npdb2.
(The format of our PDB-style files is described here.)

Timeline for d1npdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1npdb1