Lineage for d1npda2 (1npd A:1-106)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498407Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)
  6. 2498408Protein Putative shikimate dehydrogenase YdiB [82337] (1 species)
  7. 2498409Species Escherichia coli [TaxId:562] [82338] (3 PDB entries)
  8. 2498412Domain d1npda2: 1npd A:1-106 [80682]
    Other proteins in same PDB: d1npda1, d1npdb1
    structural genomics
    complexed with nad

Details for d1npda2

PDB Entry: 1npd (more details), 2.3 Å

PDB Description: x-ray structure of shikimate dehydrogenase complexed with nad+ from e.coli (ydib) northeast structural genomics research consortium (nesg) target er24
PDB Compounds: (A:) hypothetical shikimate 5-dehydrogenase-like protein ydib

SCOPe Domain Sequences for d1npda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npda2 c.58.1.5 (A:1-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]}
mdvtakyeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalk
mrgtgvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgynt

SCOPe Domain Coordinates for d1npda2:

Click to download the PDB-style file with coordinates for d1npda2.
(The format of our PDB-style files is described here.)

Timeline for d1npda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1npda1