Lineage for d1np7b2 (1np7 B:1-204)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842687Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 1842688Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 1842689Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 proteins)
  6. 1842690Protein Cryptochrome [82367] (3 species)
  7. 1842693Species Synechocystis sp. PCC 6803 [TaxId:1148] [82368] (1 PDB entry)
  8. 1842695Domain d1np7b2: 1np7 B:1-204 [80680]
    Other proteins in same PDB: d1np7a1, d1np7b1
    complexed with fad, so4

Details for d1np7b2

PDB Entry: 1np7 (more details), 1.9 Å

PDB Description: Crystal Structure Analysis of Synechocystis sp. PCC6803 cryptochrome
PDB Compounds: (B:) DNA photolyase

SCOPe Domain Sequences for d1np7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1np7b2 c.28.1.1 (B:1-204) Cryptochrome {Synechocystis sp. PCC 6803 [TaxId: 1148]}
mkhvpptvlvwfrndlrlhdheplhralksglaitavycydprqfaqthqgfaktgpwrs
nflqqsvqnlaeslqkvgnkllvttglpeqvipqiakqinaktiyyhrevtqeeldvern
lvkqltilgieakgywgstlchpedlpfsiqdlpdlftkfrkdiekkkisirpcffapsq
llpspnikleltapppeffpqinf

SCOPe Domain Coordinates for d1np7b2:

Click to download the PDB-style file with coordinates for d1np7b2.
(The format of our PDB-style files is described here.)

Timeline for d1np7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1np7b1