Lineage for d1np7a2 (1np7 A:1-204)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242399Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 242400Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family) (S)
  5. 242401Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins)
  6. 242402Protein Cryptochrome [82367] (1 species)
  7. 242403Species Synechocystis sp., pcc 6803 [TaxId:1148] [82368] (1 PDB entry)
  8. 242404Domain d1np7a2: 1np7 A:1-204 [80678]
    Other proteins in same PDB: d1np7a1, d1np7b1

Details for d1np7a2

PDB Entry: 1np7 (more details), 1.9 Å

PDB Description: Crystal Structure Analysis of Synechocystis sp. PCC6803 cryptochrome

SCOP Domain Sequences for d1np7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803}
mkhvpptvlvwfrndlrlhdheplhralksglaitavycydprqfaqthqgfaktgpwrs
nflqqsvqnlaeslqkvgnkllvttglpeqvipqiakqinaktiyyhrevtqeeldvern
lvkqltilgieakgywgstlchpedlpfsiqdlpdlftkfrkdiekkkisirpcffapsq
llpspnikleltapppeffpqinf

SCOP Domain Coordinates for d1np7a2:

Click to download the PDB-style file with coordinates for d1np7a2.
(The format of our PDB-style files is described here.)

Timeline for d1np7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1np7a1