Lineage for d1nnja2 (1nnj A:1-131)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086077Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2086078Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
    automatically mapped to Pfam PF01149
  5. 2086079Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)
  6. 2086080Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 2086110Species Lactococcus lactis [TaxId:1358] [81617] (7 PDB entries)
    Uniprot P42371
  8. 2086116Domain d1nnja2: 1nnj A:1-131 [80670]
    Other proteins in same PDB: d1nnja1, d1nnja3
    protein/DNA complex; complexed with gol, zn

Details for d1nnja2

PDB Entry: 1nnj (more details), 1.9 Å

PDB Description: crystal structure complex between the lactococcus lactis fpg and an abasic site containing dna
PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d1nnja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnja2 b.113.1.1 (A:1-131) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
qvlpyflkkki

SCOPe Domain Coordinates for d1nnja2:

Click to download the PDB-style file with coordinates for d1nnja2.
(The format of our PDB-style files is described here.)

Timeline for d1nnja2: