| Class b: All beta proteins [48724] (165 folds) |
| Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) ![]() |
| Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins) |
| Protein DNA repair protein MutM (Fpg) [81621] (4 species) |
| Species Lactococcus lactis [TaxId:1358] [81617] (7 PDB entries) |
| Domain d1nnja2: 1nnj A:1-131 [80670] Other proteins in same PDB: d1nnja1, d1nnja3 complexed with cry, pdi, zn; mutant |
PDB Entry: 1nnj (more details), 1.9 Å
SCOP Domain Sequences for d1nnja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nnja2 b.113.1.1 (A:1-131) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
qvlpyflkkki
Timeline for d1nnja2: