Lineage for d1nnja1 (1nnj A:132-219)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545373Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 545374Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 545396Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 545397Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 545411Species Lactococcus lactis [TaxId:1358] [81615] (6 PDB entries)
  8. 545414Domain d1nnja1: 1nnj A:132-219 [80669]
    Other proteins in same PDB: d1nnja2, d1nnja3
    complexed with cry, pdi, zn; mutant

Details for d1nnja1

PDB Entry: 1nnj (more details), 1.9 Å

PDB Description: crystal structure complex between the lactococcus lactis fpg and an abasic site containing dna

SCOP Domain Sequences for d1nnja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnja1 a.156.1.2 (A:132-219) DNA repair protein MutM (Fpg) {Lactococcus lactis}
gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpeketnq
liessihllhdsiieilqkaiklggssi

SCOP Domain Coordinates for d1nnja1:

Click to download the PDB-style file with coordinates for d1nnja1.
(The format of our PDB-style files is described here.)

Timeline for d1nnja1: