SCOP 1.65: Domain d1nmuc_: 1nmu C:

Lineage for d1nmuc_ (1nmu C:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (21 proteins)

6. Protein D-maltodextrin-binding protein, MBP [53862] (3 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (30 PDB entries)

8. Domain d1nmuc_: 1nmu C: [80667]
   Other proteins in same PDB: d1nmub_, d1nmud_
   chimera with yeast L30e ribosomal protein
   complexed with mtt

Details for d1nmuc_

PDB Entry: 1nmu, 2.31 Å

PDB Description: mbp-l30

SCOP Domain Sequences for d1nmuc_:

Sequence; same for both SEQRES and ATOM records:

>d1nmuc_ c.94.1.1 (C:) D-maltodextrin-binding protein, MBP {Escherichia coli}
eegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifw
ahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdll
pnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvg
vdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvny
gvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgav
alksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealk
daqtnsss

Timeline for d1nmuc_:

• d1nmuc_ first appeared in SCOP 1.63
  
• d1nmuc_ appears in SCOP 1.67
  
• d1nmuc_ appears in the current release, SCOPe 2.08, called d1nmuc1